Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). Source: Recombinant protein corresponding to aa1-37 from Artemisia vulgaris Non-specific lipid-transfer protein, fused to NO-Tag, expressed in E.coli. Molecular Weight: ~3.8kD Amino Acid Sequence: ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
