Non-structural Protein 3b, Recombinant, Avian Infectious Bronchitis Virus, aa1-64, His-Tag

Produktübersicht

• Artikelname: Non-structural Protein 3b, Recombinant, Avian Infectious Bronchitis Virus, aa1-64, His-Tag
• Artikelnummer: USB-585547
• Hersteller Artikelnummer: 585547
• Alternativnummer: USB-585547-20, USB-585547-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-64 from Avian infectious bronchitis virus Non-structural protein 3b, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~8.4kD Amino Acid Sequence: MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 8.4
• UniProt: P30241
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.