Normal Mucosa of Esophagus-specific Gene 1 Protein, Recombinant, Mouse, aa1-83, Flag-Myc-Tag

Produktübersicht

• Artikelname: Normal Mucosa of Esophagus-specific Gene 1 Protein, Recombinant, Mouse, aa1-83, Flag-Myc-Tag
• Artikelnummer: USB-585550
• Hersteller Artikelnummer: 585550
• Alternativnummer: USB-585550-20, USB-585550-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-83 from mouse Normal mucosa of esophagus-specific gene 1 protein, fused to Flag-Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~12.6kD Amino Acid Sequence: MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 12.6
• UniProt: Q810Q5
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.