Nuclear Export Protein, Recombinant, Influenza B virus, aa1-122, His-Tag, Myc-Tag

Artikelnummer: USB-585560
Artikelname: Nuclear Export Protein, Recombinant, Influenza B virus, aa1-122, His-Tag, Myc-Tag
Artikelnummer: USB-585560
Hersteller Artikelnummer: 585560
Alternativnummer: USB-585560-20, USB-585560-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates the nuclear export of encapsidated genomic RNAs (ribonucleoproteins, RNPs). Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced. Source: Recombinant protein corresponding to aa1-122 from Influenza B virus Nuclear export protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~21.8kD Amino Acid Sequence: MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.8
UniProt: P08014
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol