Nucleoprotein, Recombinant, Avian Infectious Bronchitis Virus, aa1-409, His-Tag

Artikelnummer: USB-585581
Artikelname: Nucleoprotein, Recombinant, Avian Infectious Bronchitis Virus, aa1-409, His-Tag
Artikelnummer: USB-585581
Hersteller Artikelnummer: 585581
Alternativnummer: USB-585581-20,USB-585581-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Source: Recombinant protein corresponding to aa1-409 from Avian infectious bronchitis virus Nucleoprotein, fused to 6X His-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~48kD Amino Acid Sequence: MSAGKLKFDSPAPILKLSKNTGSTPPKVGGTGQASWFQSLKEKKRTGTPPTFEGSGVPDNSNVKPQFQHGYWKRQHRYKPGKGGRKPVADAWYFYYTGTGPFGDLKWGDSNDDVVWVKAKGADTSKIGNYGVRDPDKFDQAPLRFTEGGPDNNYRWDFIALNRGRSRNSSAVTSRENSRPGSRDSSRGRQRSRVDDDLIDRAAKIIMQQQKNGSRISKQKANEMAERKYHKRAIAPGKRIDEVFGQRRKGQAPNFGDDKMIEEGVKDGRLTAMLNLVPTPHACLLGSMVTAKLQPDGLHVRFSFETVVKREDPQFANYSKICDECVDGVGTRPKDDPTPRSRAASKDRNSAPATPKQQRAKKVHKKKEEESSLTEEEEEVNKQLEYDDDVTDIPNKIDWGEGAFDDINI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48
UniProt: Q96605
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.