Odorant-binding Protein, Recombinant, Bovine, aa1-159, His-Tag

Artikelnummer: USB-585626
Artikelname: Odorant-binding Protein, Recombinant, Bovine, aa1-159, His-Tag
Artikelnummer: USB-585626
Hersteller Artikelnummer: 585626
Alternativnummer: USB-585626-20, USB-585626-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This protein binds a wide variety of chemical odorants. Source: Recombinant protein corresponding to aa1-159 from bovine Odorant-binding protein, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.5kD Amino Acid Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.5
UniProt: P07435
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.