Outer Capsid Glycoprotein VP7, Recombinant, Rotavirus A, aa34-309, His-Tag

Artikelnummer: USB-585655
Artikelname: Outer Capsid Glycoprotein VP7, Recombinant, Rotavirus A, aa34-309, His-Tag
Artikelnummer: USB-585655
Hersteller Artikelnummer: 585655
Alternativnummer: USB-585655-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7. Source: Recombinant protein corresponding to aa34-309 from Rotavirus A Outer capsid glycoprotein VP7, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~33.0kD Amino Acid Sequence: QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33
UniProt: A8D8S8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.