Outer Membrane Protein A, Recombinant, Klebsiella pneumoniae, aa190-344, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Outer Membrane Protein A, Recombinant, Klebsiella pneumoniae, aa190-344, His-Tag, Myc-Tag
• Artikelnummer: USB-585666
• Hersteller Artikelnummer: 585666
• Alternativnummer: USB-585666-20, USB-585666-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm. Acts as a porin with low permeability that allows slow penetration of small solutes, an internal gate slows down solute passage., Required for conjugation with F-type plasmids, probably serves as the mating receptor on recipient cells. Source: Recombinant protein corresponding to aa190-344 from Klebsiella pneumoniae Outer membrane protein A, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~24.0kD Amino Acid Sequence: GQEDAAPVVAPAPAPAPEVATKHFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEAYNQQLSEKRAQSVVDYLVAKGIPAGKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGYKEVVTQPQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 24
• UniProt: P24017
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.