Outer Membrane Protein YopM, Recombinant, Yersinia pestis, aa1-409, His-SUMO-Tag

Artikelnummer: USB-585676
Artikelname: Outer Membrane Protein YopM, Recombinant, Yersinia pestis, aa1-409, His-SUMO-Tag
Artikelnummer: USB-585676
Hersteller Artikelnummer: 585676
Alternativnummer: USB-585676-20, USB-585676-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. Source: Recombinant protein corresponding to aa1-409 from Yersinia pestis Outer membrane protein YopM, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~62.2kD Amino Acid Sequence: MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 62.2
UniProt: P17778
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.