Outer Membrane Virulence Protein YopE, Recombinant, Yersinia enterocolitica, aa1-219, His-Tag

Artikelnummer: USB-585679
Artikelname: Outer Membrane Virulence Protein YopE, Recombinant, Yersinia enterocolitica, aa1-219, His-Tag
Artikelnummer: USB-585679
Hersteller Artikelnummer: 585679
Alternativnummer: USB-585679-20,USB-585679-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Essential virulence determinant, cytotoxic effector, involved in resistance to phagocytosis. Source: Recombinant protein corresponding to aa1-219 from Yersinia enterocolitica Outer membrane virulence protein YopE, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.9kD Amino Acid Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.9
UniProt: P31492
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.