Parathyroid Hormone, Recombinant, Rat, aa32-115, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Parathyroid Hormone, Recombinant, Rat, aa32-115, His-Tag, Myc-Tag
• Artikelnummer: USB-585699
• Hersteller Artikelnummer: 585699
• Alternativnummer: USB-585699-20, USB-585699-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. Source: Recombinant protein corresponding to aa32-115 from rat Parathyroid hormone, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~16.9kD Amino Acid Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 16.9
• UniProt: Q9XT35
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.