Pectate Lyase 1, Recombinant, Hesperocyparis Arizonica, aa22-367, His-GST-Tag, Myc-Tag

Artikelnummer: USB-585701
Artikelname: Pectate Lyase 1, Recombinant, Hesperocyparis Arizonica, aa22-367, His-GST-Tag, Myc-Tag
Artikelnummer: USB-585701
Hersteller Artikelnummer: 585701
Alternativnummer: USB-585701-20, USB-585701-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has pectate lyase activity. Source: Recombinant protein corresponding to aa22-367 from Hesperocyparis arizonica Pectate lyase 1, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~65.1kD Amino Acid Sequence: ADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 65.1
UniProt: Q9SCG9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.