Pectate Lyase 1, Recombinant, Hesperocyparis arizonica, aa22-367, His-Tag

Artikelnummer: USB-585702
Artikelname: Pectate Lyase 1, Recombinant, Hesperocyparis arizonica, aa22-367, His-Tag
Artikelnummer: USB-585702
Hersteller Artikelnummer: 585702
Alternativnummer: USB-585702-20,USB-585702-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has pectate lyase activity. Source: Recombinant protein corresponding to aa22-367 from Hesperocyparis arizonica Pectate lyase 1, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~40.1kD Amino Acid Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40.1
UniProt: Q9SCG9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.