Pepsin A-5, Recombinant, Human, aa63-388, His-Tag, Myc-Tag

Artikelnummer: USB-585709
Artikelname: Pepsin A-5, Recombinant, Human, aa63-388, His-Tag, Myc-Tag
Artikelnummer: USB-585709
Hersteller Artikelnummer: 585709
Alternativnummer: USB-585709-20,USB-585709-100,USB-585709-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Shows particularly broad specificity, although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent. Source: Recombinant protein corresponding to aa63-388 from human Pepsin A-5, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~41.6kD Amino Acid Sequence: VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41.6
UniProt: P0DJD9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.