Peptidoglycan-associated Lipoprotein, Recombinant, E. coli, aa22-173, His-Tag, Myc-Tag
Artikelnummer:
USB-585715
Hersteller Artikelnummer:
585715
Alternativnummer:
USB-585715-20, USB-585715-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. The Tol-Pal system is also required for polar localization of chemoreceptors clusters. The system also appears to be required for the activity of several outer membrane-localized enzymes with cell wall remodeling activity. Source: Recombinant protein corresponding to aa22-173 from Escherichia coli Peptidoglycan-associated lipoprotein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~24.1kD Amino Acid Sequence: CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.