Peptidoglycan-associated Lipoprotein, Recombinant, Legionella pneumophila, aa22-176, His-SUMO-Tag

Artikelnummer: USB-585716
Artikelname: Peptidoglycan-associated Lipoprotein, Recombinant, Legionella pneumophila, aa22-176, His-SUMO-Tag
Artikelnummer: USB-585716
Hersteller Artikelnummer: 585716
Alternativnummer: USB-585716-20,USB-585716-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Very strongly associated with the peptidoglycan. Source: Recombinant protein corresponding to aa22-176 from Legionella pneumophila Peptidoglycan-associated lipoprotein, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.8kD Amino Acid Sequence: CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.8
UniProt: P26493
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.