Perilipin-4, Recombinant, Human, aa2-144, His-Tag

Artikelnummer: USB-585722
Artikelname: Perilipin-4, Recombinant, Human, aa2-144, His-Tag
Artikelnummer: USB-585722
Hersteller Artikelnummer: 585722
Alternativnummer: USB-585722-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Required for resistance to DNA-damaging agents. Source: Recombinant protein corresponding to aa2-144 from human Perilipin-4, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~19.9kD Amino Acid Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.9
UniProt: Q96Q06
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.