Pesticidal Crystal Protein Cry1Ac, Recombinant, Bacillus thuringiensis subsp., aa972-1178, GST-Tag

Artikelnummer: USB-585739
Artikelname: Pesticidal Crystal Protein Cry1Ac, Recombinant, Bacillus thuringiensis subsp., aa972-1178, GST-Tag
Artikelnummer: USB-585739
Hersteller Artikelnummer: 585739
Alternativnummer: USB-585739-20, USB-585739-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Source: Recombinant protein corresponding to aa972-1178 from Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~50.8kD Amino Acid Sequence: LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 50.8
UniProt: P05068
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.