Pesticidal Crystal Protein Cry1Fb, Recombinant, Bacillus thuringiensis subsp., aa984-1159, His-Tag
Artikelnummer:
USB-585740
Hersteller Artikelnummer:
585740
Alternativnummer:
USB-585740-20, USB-585740-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. Source: Recombinant protein corresponding to aa984-1159 from Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.8kD Amino Acid Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten