Phospholipase A-2-activating Protein, Recombinant, Mouse, aa495-584, His-Tag, Myc-Tag

Artikelnummer: USB-585761
Artikelname: Phospholipase A-2-activating Protein, Recombinant, Mouse, aa495-584, His-Tag, Myc-Tag
Artikelnummer: USB-585761
Hersteller Artikelnummer: 585761
Alternativnummer: USB-585761-20, USB-585761-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in protein ubiquitination, sorting and degradation through its association with VCP (By similarity). Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. Source: Recombinant protein corresponding to aa495-584 from mouse Phospholipase A-2-activating protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~14.7kD Amino Acid Sequence: TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.7
UniProt: P27612
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.