Phospholipase D LamSicTox-alphaIC1, Recombinant, Loxosceles amazonica, aa1-273, His-Tag
Artikelnummer:
USB-585771
Hersteller Artikelnummer:
585771
Alternativnummer:
USB-585771-20, USB-585771-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Dermonecrotic toxins cleave the phosphodiester linkage between the phosphate and headgroup of certain phospholipids (sphingolipid and lysolipid substrates), forming an alcohol (often choline) and a cyclic phosphate. This toxin acts on sphingomyelin (SM). It may also act on ceramide phosphoethanolamine (CPE), lysophosphatidylcholine (LPC) and lysophosphatidylethanolamine (LPE), but not on lysophosphatidylserine (LPS), and lysophosphatidylglycerol (LPG). It acts by transphosphatidylation, releasing exclusively cyclic phosphate products as second products. Induces dermonecrosis, hemolysis, increased vascular permeability, edema, inflammatory response, and platelet aggregation. Source: Recombinant protein corresponding to aa1-273 from Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~34.8kD Amino Acid Sequence: WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten