Placenta-expressed Transcript 1 Protein, Recombinant, Mesocricetus auratus, aa27-223, His-Tag, Myc-Tag

Artikelnummer: USB-585787
Artikelname: Placenta-expressed Transcript 1 Protein, Recombinant, Mesocricetus auratus, aa27-223, His-Tag, Myc-Tag
Artikelnummer: USB-585787
Hersteller Artikelnummer: 585787
Alternativnummer: USB-585787-20,USB-585787-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle. Source: Recombinant protein corresponding to aa27-223 from Mesocricetus auratus Placenta-expressed transcript 1 protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~25.8kD Amino Acid Sequence: ASYNDPCTVFDTISTTNLRVNITAEGSGENITYTVWVHVNSSVSVVILKAVNQDNKPVGTWVGATQECNDSSVLYRVTPSDNSDFQATWIVPNSEDITKVNLHVLMAIGNGTAAVTSVNLGEPQTSTPLRPTPEISETNQTTTMTTDKTPAMTTAKTPAMTTAKTTAKTTAKTTVKTTAMTTAKTTAKSLAVNALGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.8
UniProt: Q5W9T8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.