Plasmepsin-1, Recombinant, Plasmodium Falciparum, aa125-452, His-Tag, Myc-Tag

Artikelnummer: USB-585794
Artikelname: Plasmepsin-1, Recombinant, Plasmodium Falciparum, aa125-452, His-Tag, Myc-Tag
Artikelnummer: USB-585794
Hersteller Artikelnummer: 585794
Alternativnummer: USB-585794-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Participates in the digestion of the host hemoglobin. Initial cleavage at the hinge region of hemoglobin, than cleaves at other sites, leading to denaturation of the molecule and to further degradation. Source: Recombinant protein corresponding to aa125-452 from Plasmodium falciparum Plasmepsin-1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~40.8kD Amino Acid Sequence: AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40.8
UniProt: P39898
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.