Plasmid-derived Single-stranded DNA-binding Protein, Recombinant, E. coli, aa2-179, His-SUMO-Tag

Artikelnummer: USB-585797
Artikelname: Plasmid-derived Single-stranded DNA-binding Protein, Recombinant, E. coli, aa2-179, His-SUMO-Tag
Artikelnummer: USB-585797
Hersteller Artikelnummer: 585797
Alternativnummer: USB-585797-20, USB-585797-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May contribute to the conjugative processing of DNA. It has a functional relationship with Psi (plasmid-mediated sos inhibition) proteins. Source: Recombinant protein corresponding to aa2-179 from Plasmid-derived single-stranded DNA-binding protein, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.5kD Amino Acid Sequence: AVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGECLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVKTTGTMQMLVRAAGAQTQPEEGQQFSGQPQPEPQAEAGTKKGGAKTKGRGRKAAQPEPQPQPPEGDDYGFSDDIPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.5
UniProt: P18310
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.