Plasmodesmata-located Protein 7, Recombinant, Arabidopsis thaliana, aa31-298, GST-Tag

Artikelnummer: USB-585803
Artikelname: Plasmodesmata-located Protein 7, Recombinant, Arabidopsis thaliana, aa31-298, GST-Tag
Artikelnummer: USB-585803
Hersteller Artikelnummer: 585803
Alternativnummer: USB-585803-20, USB-585803-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Modulates cell-to-cell trafficking. Source: Recombinant protein corresponding to aa31-298 from Arabidopsis thaliana Plasmodesmata-located protein 7, fused to GST His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~54.8kD Amino Acid Sequence: TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 54.8
UniProt: Q0WPN8
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.