Pregnancy-associated Glycoprotein 2, Recombinant, Bovine, aa22-376, His-Tag

Artikelnummer: USB-585866
Artikelname: Pregnancy-associated Glycoprotein 2, Recombinant, Bovine, aa22-376, His-Tag
Artikelnummer: USB-585866
Hersteller Artikelnummer: 585866
Alternativnummer: USB-585866-20, USB-585866-100
Hersteller: US Biological
Kategorie: Molekularbiologie
PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor. Source: Recombinant protein corresponding to aa22-376 from bovine Pregnancy-associated glycoprotein 2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.1kD Amino Acid Sequence: KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.1
UniProt: Q28057
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.