Pro-epidermal Growth Factor, Recombinant, Human, aa977-1023, GST-Tag

Artikelnummer: USB-585869
Artikelname: Pro-epidermal Growth Factor, Recombinant, Human, aa977-1023, GST-Tag
Artikelnummer: USB-585869
Hersteller Artikelnummer: 585869
Alternativnummer: USB-585869-20, USB-585869-100
Hersteller: US Biological
Kategorie: Molekularbiologie
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. Partial recombinant protein corresponding to aa977-1023 from human Pro-epidermal growth factor, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.6kD Amino Acid Sequence: PLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.6
UniProt: P01133
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.