Shows esterase activity, with a preference for short- and medium-chain fatty acids. Has also weak lipase activity, but does not exhibit cutinase activity. Hydrolyzes various esters, including pNP-butyrate (C4), pNP-valerate (C5), pNP-hexanoate (C6), pNP-octanoate (C8) and pNP-decanoate (C10). Can use pNP-laurate (C12) and pNP-myristate (C14), with lower efficiency. Can also hydrolyze monocaprylin and triolein, with a slow turnover., Induces a strong delayed-type hypersensitivity (DTH) response in animal model of tuberculosis, cellular and humoral immune responses. Induces interferon-gamma (IFN-gamma) release in animal models and in human TB patients. Also induces IL-12 responses in mouse model. Source: Recombinant protein corresponding to aa33-217 from Mycobacterium tuberculosis Probable cutinase Rv1984c, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~38.7kD Amino Acid Sequence: DPCSDIAVVFARGTHQASGLGDVGEAFVDSLTSQVGGRSIGVYAVNYPASDDYRASASNGSDDASAHIQRTVASCPNTRIVLGGYSQGATVIDLSTSAMPPAVADHVAAVALFGEPSSGFSSMLWGGGSLPTIGPLYSSKTINLCAPDDPICTGGGNIMAHVSYVQSGMTSQAATFAANRLDHAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
