Probable Ganciclovir Kinase, Recombinant, Human herpesvirus 6A, aa170-355, His-Tag

Artikelnummer: USB-585881
Artikelname: Probable Ganciclovir Kinase, Recombinant, Human herpesvirus 6A, aa170-355, His-Tag
Artikelnummer: USB-585881
Hersteller Artikelnummer: 585881
Alternativnummer: USB-585881-20, USB-585881-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Phosphorylates the antiviral nucleoside analog ganciclovir. Source: Recombinant protein corresponding to aa170-355 from human herpesvirus 6A Probable ganciclovir kinase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.1kD Amino Acid Sequence: SEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAIKTANEDESVISAFIAGVIRAKSGADLLSHECVINNLLISNSVCMSHKVSLSRTYDIDLHKFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFLNHKKEIIFDAVLADYSLSEMHPNYNGTCAIAKEY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.1
UniProt: P24446
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.