Proheparin-binding EGF-like Growth Factor, Recombinant, Human, aa63-148, His-Tag

Artikelnummer: USB-585906
Artikelname: Proheparin-binding EGF-like Growth Factor, Recombinant, Human, aa63-148, His-Tag
Artikelnummer: USB-585906
Hersteller Artikelnummer: 585906
Alternativnummer: USB-585906-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. Source: Recombinant protein corresponding to aa63-148 from human Proheparin-binding EGF-like growth factor, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~11.7kD Amino Acid Sequence: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.7
UniProt: Q99075
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.