Prolactin, Recombinant, Equine, aa31-229, His-Tag

Artikelnummer: USB-585914
Artikelname: Prolactin, Recombinant, Equine, aa31-229, His-Tag
Artikelnummer: USB-585914
Hersteller Artikelnummer: 585914
Alternativnummer: USB-585914-20, USB-585914-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Prolactin acts primarily on the mammary gland by promoting lactation. Source: Recombinant protein corresponding to aa31-229 from equine Prolactin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.0kD Amino Acid Sequence: LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29
UniProt: P12420
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.