Proline-rich P65 Protein, Recombinant, Mycoplasma Pneumoniae, aa1-405, His-Tag, Myc-Tag

Artikelnummer: USB-585917
Artikelname: Proline-rich P65 Protein, Recombinant, Mycoplasma Pneumoniae, aa1-405, His-Tag, Myc-Tag
Artikelnummer: USB-585917
Hersteller Artikelnummer: 585917
Alternativnummer: USB-585917-20,USB-585917-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-405 from Mycoplasma pneumoniae Proline-rich P65 protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~54.5kD Amino Acid Sequence: MDINKPGWNQSDQQATAYDPNQQQYYGDGSTYYDPDQAVDPNQAYYPDPNTYPDAAAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPNAYVDPNAYQDPNAYVDPNNYTDPNAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPYYVTSTDPNAYYGQVDNVPALEASDLAYEVTPQEQAAEQELFSEPETKVIREIHEFPFEKIRSYFQTDFDSYNSRLTQLKDKLDNAIFSMRKAIDTVKENSANLQIMKQNFERQLKEQQTQRLTSNTDAEKIGAKINQLEERMQRLSRTMESVEWTKKEPRQEQFDPRFVDPRNFNNYVNNTDTMMSMFEKVLMMNLLRSTTPVQPPVQYFTPQPLTASPRPVYEEPISASFRRRGYRGDEFYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 54.5
UniProt: P0CJ81
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.