Promotilin, Recombinant, Human, aa26-115, His-GST-Tag, Myc-Tag

Artikelnummer: USB-585922
Artikelname: Promotilin, Recombinant, Human, aa26-115, His-GST-Tag, Myc-Tag
Artikelnummer: USB-585922
Hersteller Artikelnummer: 585922
Alternativnummer: USB-585922-20,USB-585922-100,USB-585922-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. Source: Recombinant protein corresponding to aa26-115 from human Promotilin, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~45.5kD Amino Acid Sequence: FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 45.5
UniProt: P12872
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.