Prophage Outer Membrane Lipoprotein RzoR, Recombinant, E. coli, aa20-61, His-KSI-Tag

Artikelnummer: USB-585926
Artikelname: Prophage Outer Membrane Lipoprotein RzoR, Recombinant, E. coli, aa20-61, His-KSI-Tag
Artikelnummer: USB-585926
Hersteller Artikelnummer: 585926
Alternativnummer: USB-585926-20, USB-585926-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. Source: Recombinant protein corresponding to aa20-61 from Escherichia coli Prophage outer membrane lipoprotein RzoR, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.9kD Amino Acid Sequence: CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.9
UniProt: P58042
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.