Protein A33, Recombinant, Vaccinia virus, aa57-185, His-Tag
Artikelnummer:
USB-585931
Hersteller Artikelnummer:
585931
Alternativnummer:
USB-585931-20, USB-585931-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. Source: Recombinant protein corresponding to aa57-185 from Vaccinia virus Protein A33, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.2kD Amino Acid Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten