Protein B5, Recombinant, Vaccinia virus, aa18-279, His-Tag

Artikelnummer: USB-585940
Artikelname: Protein B5, Recombinant, Vaccinia virus, aa18-279, His-Tag
Artikelnummer: USB-585940
Hersteller Artikelnummer: 585940
Alternativnummer: USB-585940-20, USB-585940-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Source: Recombinant protein corresponding to aa18-279 from Vaccinia virus Protein B5, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~31.1kD Amino Acid Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.1
UniProt: Q01227
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol