Protein B5, Recombinant, Vaccinia Virus, aa18-279, His-Tag, Myc-Tag

Artikelnummer: USB-585942
Artikelname: Protein B5, Recombinant, Vaccinia Virus, aa18-279, His-Tag, Myc-Tag
Artikelnummer: USB-585942
Hersteller Artikelnummer: 585942
Alternativnummer: USB-585942-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV) (By similarity). Source: Recombinant protein corresponding to aa18-279 from Vaccinia virus Protein B5, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~33.0kD Amino Acid Sequence: YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33
UniProt: P21115
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol