Protein FAM3B, Recombinant, Mouse, aa30-235, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Protein FAM3B, Recombinant, Mouse, aa30-235, His-Tag, Myc-Tag
• Artikelnummer: USB-585970
• Hersteller Artikelnummer: 585970
• Alternativnummer: USB-585970-20
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Source: Recombinant protein corresponding to aa30-235 from mouse Protein FAM3B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~26.8kD Amino Acid Sequence: ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.8
• UniProt: Q9D309
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.