Protein FAM72A, Recombinant, Human, aa1-149

Artikelnummer: USB-585971
Artikelname: Protein FAM72A, Recombinant, Human, aa1-149
Artikelnummer: USB-585971
Hersteller Artikelnummer: 585971
Alternativnummer: USB-585971-20, USB-585971-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in the regulation of cellular reactive oxygen species metabolism. May participate in cell growth regulation. Full length recombinant protein corresponding to aa1-149 from human Protein FAM72A, expressed in E.coli. Molecular Weight: ~16.8kD Amino Acid Sequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.8
UniProt: Q5TYM5
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.