Protein K3, Recombinant, Vaccinia virus, aa1-88, His-SUMO-Tag

Produktübersicht

• Artikelname: Protein K3, Recombinant, Vaccinia virus, aa1-88, His-SUMO-Tag
• Artikelnummer: USB-585978
• Hersteller Artikelnummer: 585978
• Alternativnummer: USB-585978-20,USB-585978-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Source: Recombinant protein corresponding to aa1-88 from Vaccinia virus Protein K3, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.6kD Amino Acid Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.6
• UniProt: P18378
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.