Protein L1, Recombinant, Vaccinia Virus, aa2-183, His-Tag, His-Myc-Tag
Artikelnummer:
USB-585983
Hersteller Artikelnummer:
585983
Alternativnummer:
USB-585983-20, USB-585983-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Source: Recombinant protein corresponding to aa2-183 from Vaccinia virus Protein L1, fused to 10X His-Tag at N-terminal and 6X His-MycTag at C-terminal, expressed in Yeast. Molecular Weight: ~25.4kD Amino Acid Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten