Protein L3, Recombinant, Vaccinia virus, aa1-350, His-Tag

Produktübersicht

• Artikelname: Protein L3, Recombinant, Vaccinia virus, aa1-350, His-Tag
• Artikelnummer: USB-585988
• Hersteller Artikelnummer: 585988
• Alternativnummer: USB-585988-20,USB-585988-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Might be required for transcription of early genes. Source: Recombinant protein corresponding to aa1-350 from Vaccinia virus Protein L3, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.6kD Amino Acid Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 42.6
• UniProt: P07614
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.