Protein Wnt-7b, Recombinant, Human, aa25-349, His-SUMO-Tag, Myc-Tag

Artikelnummer: USB-586040
Artikelname: Protein Wnt-7b, Recombinant, Human, aa25-349, His-SUMO-Tag, Myc-Tag
Artikelnummer: USB-586040
Hersteller Artikelnummer: 586040
Alternativnummer: USB-586040-20,USB-586040-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity). Source: Recombinant protein corresponding to aa25-349 from human Protein Wnt-7b, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~56.3kD Amino Acid Sequence: ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 56.3
UniProt: P56706
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol