Prunus Persica Putative Allergen Pru p 1.01, Recombinant, Prunus dulcis x, aa1-160, His-SUMO-Tag

Artikelnummer: USB-586066
Artikelname: Prunus Persica Putative Allergen Pru p 1.01, Recombinant, Prunus dulcis x, aa1-160, His-SUMO-Tag
Artikelnummer: USB-586066
Hersteller Artikelnummer: 586066
Alternativnummer: USB-586066-20,USB-586066-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-160 from Prunus dulcis x Prunus persica Putative allergen Pru p 1.01, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.6kD Amino Acid Sequence: MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.6
UniProt: B6CQR8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.