Pterin-4-alpha-carbinolamine Dehydratase, Recombinant, Human, aa2-104, His-GST-Tag

Artikelnummer: USB-586067
Artikelname: Pterin-4-alpha-carbinolamine Dehydratase, Recombinant, Human, aa2-104, His-GST-Tag
Artikelnummer: USB-586067
Hersteller Artikelnummer: 586067
Alternativnummer: USB-586067-20, USB-586067-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Source: Recombinant protein corresponding to aa2-104 from human Pterin-4-alpha-carbinolamine dehydratase, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.9kD Amino Acid Sequence: AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41.9
UniProt: P61457
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.