Pulmonary Surfactant-associated Protein B Recombinant, Porcine, aa1-79

Artikelnummer: USB-586070
Artikelname: Pulmonary Surfactant-associated Protein B Recombinant, Porcine, aa1-79
Artikelnummer: USB-586070
Hersteller Artikelnummer: 586070
Alternativnummer: USB-586070-20,USB-586070-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Source: Recombinant protein corresponding to aa1-79 from porcine Pulmonary surfactant-associated protein B, expressed in E.coli. Molecular Weight: ~8.7kD Amino Acid Sequence: FPIPLPFCWLCRTLIKRIQAVVPKGVLLKAVAQVCHVVPLPVGGICQCLAERYIVICLNMLLDRTLPQLVCGLVLRCSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 8.7
UniProt: P15782
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.