Pulmonary Surfactant-associated Protein B, Recombinant, Human, aa201-279, MBP-Tag
Artikelnummer:
USB-586074
Hersteller Artikelnummer:
586074
Alternativnummer:
USB-586074-20
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Source: Recombinant protein corresponding to aa201-279 from human Pulmonary surfactant-associated protein B, fused to MBP-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~50.7kD Amino Acid Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten