Pulmonary Surfactant-associated Protein C, Recombinant, Mouse, aa24-58, His-KSI-Tag

Produktübersicht

• Artikelname: Pulmonary Surfactant-associated Protein C, Recombinant, Mouse, aa24-58, His-KSI-Tag
• Artikelnummer: USB-586078
• Hersteller Artikelnummer: 586078
• Alternativnummer: USB-586078-20, USB-586078-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. Source: Recombinant protein corresponding to aa24-58 from mouse Pulmonary surfactant-associated protein C, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.1kD Amino Acid Sequence: FRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 19.1
• UniProt: P21841
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.