Putative Lipoprotein lpqE, Recombinant, Mycobacterium tuberculosis, aa30-182, His-Tag, Myc-Tag

Artikelnummer: USB-586087
Artikelname: Putative Lipoprotein lpqE, Recombinant, Mycobacterium tuberculosis, aa30-182, His-Tag, Myc-Tag
Artikelnummer: USB-586087
Hersteller Artikelnummer: 586087
Alternativnummer: USB-586087-20,USB-586087-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa30-182 from Mycobacterium tuberculosis Putative lipoprotein lpqE, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.2kD Amino Acid Sequence: CGAGQISQTANQKPAVNGNRLTINNVLLRDIRIQAVQTSDFIQPGKAVDLVLVAVNQSPDVSDRLVGITSDIGSVTVAGDARLPASGMLFVGTPDGQIVAPGPLPSNQAAKATVNLTKPIANGLTYNFTFKFEKAGQGSVMVPISAGLATPHE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.2
UniProt: P9WK62
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.