Putative Xaa-Pro Aminopeptidase, Recombinant, Mycoplasma pneumoniae, aa1-354, His-SUMO-Tag

Artikelnummer: USB-586099
Artikelname: Putative Xaa-Pro Aminopeptidase, Recombinant, Mycoplasma pneumoniae, aa1-354, His-SUMO-Tag
Artikelnummer: USB-586099
Hersteller Artikelnummer: 586099
Alternativnummer: USB-586099-20,USB-586099-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-354 from Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~55.6kD Amino Acid Sequence: MHNELQQKLAVLHKLLQDNKADAILIGSDQNRFWLTGFPSSAGWLVVHKQRVNLFIDGRYFEAAKTAIDPLVKVELFTTYKQVKALCEQVGVKHLLIEGDYLTFNYQNFIKELCAQYTVINAQEIRRQKLPSEILAIEKVVEITRKVAVKLKRFIQPGMTELFIAQWITDQLVKAGGAKNSFDPIVATGKNGANPHHKPSKLKVKSGDFVTCDFGTIYNGYCSDITRTFLVGKKPNNEVLLKAYKKVDEANMAGINAANTQLTGAEVDKVCRDIIEASEFKDYFVHSTGHGVGLDIHEMPNVSTSYNKLLCENAVITIEPGIYIPSVGGIRIEDMVLVKDHKSVWLSAKIPRAF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 55.6
UniProt: P75313
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.